PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN538805.1_FGP037
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 733aa    MW: 83968.1 Da    PI: 6.5968
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN538805.1_FGP037genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS336.35.4e-1033537251374
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                        l++lL++cA+avs ++++la+ +L+ ++++asp+gd  qRla +++  L  rl++++s++y+++ +++ +   +++ l+++++   ++P+l+
  KN538805.1_FGP037 353 LRTLLIHCAQAVSVSNHSLASDILKIIRHHASPTGDDSQRLALCLAYCLDIRLTGTGSQIYRKFITKRRN---VKDILKVFHVCISTCPFLR 441
                        6789*********************************************************999888887...9****************** PP

               GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlv 182
                         sh   N++I +  +g+++vHiiDf+i  G+QWp+L+++La+ ++ pp+lRiTg++ pesg     + +++g rLa++A+++++pfe++ + 
  KN538805.1_FGP037 442 ASHYFSNRTIIDVSKGKSQVHIIDFGICFGFQWPSLFEELAKIEDRPPKLRITGIELPESGfrPYARSKNIGLRLADYAKTFNIPFEYQHIS 533
                        ************************************************************999999************************99 PP

               GRAS 183 akrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak 274
                        ++++e+l++e+++++++E+l+Vn++++++ + de+vs++s+r++vL++++ ++Pkv+v    + +++ + Fl+rf e +++y++lfd+l+++
  KN538805.1_FGP037 534 SNKWEALSPEDFNIEKDEVLIVNCIYRMKDIGDETVSINSARSRVLNTIRMMKPKVFVQGVLNGSYGVPFFLTRFKEVMYHYTSLFDMLDKN 625
                        99****************************************************************************************** PP

               GRAS 275 lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrp 366
                        +pr++e+r+ +Er + +    nv+aceg er+er e+++kW+ r  +aG+ ++pl+  ++ + + ++rk + + + v+ee+++lvlgWk+r 
  KN538805.1_FGP037 626 IPRDNETRMILERDIYQYIMLNVIACEGPERIERPESYKKWKVRNLKAGLVQLPLNPAIVRETQDMVRKGYHKDFLVDEEDQWLVLGWKGRI 717
                        **************999999**************************************************9888****************** PP

               GRAS 367 LvsvSaWr 374
                        L++ S W+
  KN538805.1_FGP037 718 LYASSTWQ 725
                        *******6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.437327705IPR005202Transcription factor GRAS
PfamPF035141.9E-100353725IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 733 aa     Download sequence    Send to blast
MGSDDNKRFD DFHVITNGPG SDAYSNEESI NLVNKSNDSE LFLYPPSPMN YYAPLPIISE  60
KDSCVAPSTS FCSKTYNPQL YVEKGNGTAD WCQTSGDYPE KSSINSDITL SYIDKILMQE  120
DIDDRGNEDT ALQAMEEPFY ELLGQKYPPF PQQQLLCVCD RLQNLSANTD KSNGHSCDTC  180
SVTRMTNISS SMNFNGNFQG FQFPWSLSSI TRETEQFTHH SNRMVVGLKV DGLSISEKPS  240
QDNCSLQIDA HYMRKHPLFE VHDRKSYPCI EDLDLLEGRS NKQYAIYYDE PIRDEMFDKV  300
LLCYDHKPLD EGVSLSRAMT NNSSKSSQIG QEKTSARRKT AGKRIPKRDV VDLRTLLIHC  360
AQAVSVSNHS LASDILKIIR HHASPTGDDS QRLALCLAYC LDIRLTGTGS QIYRKFITKR  420
RNVKDILKVF HVCISTCPFL RASHYFSNRT IIDVSKGKSQ VHIIDFGICF GFQWPSLFEE  480
LAKIEDRPPK LRITGIELPE SGFRPYARSK NIGLRLADYA KTFNIPFEYQ HISSNKWEAL  540
SPEDFNIEKD EVLIVNCIYR MKDIGDETVS INSARSRVLN TIRMMKPKVF VQGVLNGSYG  600
VPFFLTRFKE VMYHYTSLFD MLDKNIPRDN ETRMILERDI YQYIMLNVIA CEGPERIERP  660
ESYKKWKVRN LKAGLVQLPL NPAIVRETQD MVRKGYHKDF LVDEEDQWLV LGWKGRILYA  720
SSTWQPNDSG DSD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-403577258375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126110.0CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010229538.20.0PREDICTED: scarecrow-like protein 9
TrEMBLA0A0E0D3J20.0A0A0E0D3J2_9ORYZ; Uncharacterized protein
STRINGBGIOSGA013074-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP117882640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-148GRAS family protein